PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_030E64B15.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 933aa    MW: 106289 Da    PI: 7.7799
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_030E64B15.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR177.33e-24158244190
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY +YA ++GF+vrk  s+k+  n+ +++r +vCskeg+r ++ ++  + +++raetrtgC+a+++vk +++gk++vt+++ +HnH+
  Traes_5DL_030E64B15.2 158 EFYVSYAGTAGFNVRKGCSEKT-ANNVTKSRAYVCSKEGFRPKSFTA--EPKKQRAETRTGCEAHMTVKITTSGKYVVTECVADHNHD 242
                            6*****************9999.66669*************999877..9999**********************************9 PP

                   FAR1  89 la 90 
                            l 
  Traes_5DL_030E64B15.2 243 LE 244
                            95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-21158244IPR004330FAR1 DNA binding domain
PfamPF105518.2E-24344438IPR018289MULE transposase domain
PfamPF044346.3E-6612656IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.076612659IPR007527Zinc finger, SWIM-type
SMARTSM005758.3E-7634661IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MEKEVEVKEK RGRGRPRKAV TEGNALQACV STDLGVTASQ CAVDERKKIL NKYLSKRQSR  60
PASGRPAKII SRQALAERRK RGDGGRFLAS DGPLSPQLPL ERRSKRLEKQ NLQNEKKPES  120
KEDEIVEAEQ DPETEVVAGP GGEPKVGMVF LNEDKAYEFY VSYAGTAGFN VRKGCSEKTA  180
NNVTKSRAYV CSKEGFRPKS FTAEPKKQRA ETRTGCEAHM TVKITTSGKY VVTECVADHN  240
HDLEAPVVDI QILRSQKLLA KLQQPPDPPK VVLIPNDYKN YVRTRHTTDM QLGDARAISE  300
YLQRMKGENP SFFCSIQVDE DDQFRNVFWA DVKSVMDFNY FGDVVCVDTR YSISDYCRPL  360
LLFIGVNHHK QPTIFGTAFI YDESVESFKW LFETFKSAMS GKQPRTVLTD RSTAISDAVA  420
SAWPGTAHRF SLLHLYQNAT KVLSDTFQGS ETFAHDFSRS LYDYEEEGDF LSSWEILLAK  480
YNLKDNKWLS KLYEDRERWA LPYGRDIFCA DIAATLRSDN MDAILTGVLK TEIDLPYFFN  540
RYDKFLEEKR LAEQEADYLG VQMTQRVPPL RLLWQAANTY TPALFELFRL EFELVLACMV  600
YCCGEIGPIS EYEVTVKNRP QVHFVRFDSS EYMVLCSCKK FEFVGLPCCH ALKVLEIKNI  660
KELPPQYILK RWRKDAQSES PKENFGFAAV DEDPKFTMSK RHNSLYRTLY KVAAKAAENI  720
EGQRFMESQY DQLLEQVELL LQAKLHDKPS LSTIMRSQQP NLPQNDTSNS EPRRASSKKN  780
KNVENRRQQQ SPLESSKKKK GRQAVAGLVE PEEAELPLRV LAPTISNDIP NHMSTPTNQF  840
LAPSHLMQAP YVTQQFGLNS LQGFSGMSPF GQEQSHVHLQ QPHLQQPPFH SGPQMHQAPP  900
PDIQSLQFLS SNPQLGHQTT DQGQYTIPVW DFL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1917KRGRGRPRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3600420.0AK360042.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1108P13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229039.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X2
TrEMBLW5FPU40.0W5FPU4_WHEAT; Uncharacterized protein
STRINGMLOC_17927.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-104FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]